Protein Info for AO356_01870 in Pseudomonas fluorescens FW300-N2C3

Annotation: toxin HigB-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 transmembrane" amino acids 63 to 80 (18 residues), see Phobius details PF06296: RelE" amino acids 41 to 103 (63 residues), 34.7 bits, see alignment E=9.4e-13

Best Hits

Swiss-Prot: 46% identical to HIGB2_VIBCH: Toxin HigB-2 (higB-2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 75% identity to pfo:Pfl01_0270)

Predicted SEED Role

"RelE/StbE replicon stabilization toxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WSR9 at UniProt or InterPro

Protein Sequence (104 amino acids)

>AO356_01870 toxin HigB-2 (Pseudomonas fluorescens FW300-N2C3)
MIFIETPIFTRRVKELMDDDDFAVLQKIRVCNPSAGEVMEATGGIRKIRIAAKGHGKRGG
ARVIYYHFVHASRIALLMIYPKNEQQDLTVDQRKALKLIVEHWR