Protein Info for AO356_01830 in Pseudomonas fluorescens FW300-N2C3

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 26 to 93 (68 residues), 59.1 bits, E=2e-20

Best Hits

Swiss-Prot: 55% identical to SHDHL_HAEIN: Shikimate dehydrogenase-like protein HI_0607 (sdhL) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 97% identity to pba:PSEBR_a1801)

Predicted SEED Role

"Shikimate 5-dehydrogenase I gamma (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See A0A0N9W2X8 at UniProt or InterPro

Protein Sequence (273 amino acids)

>AO356_01830 shikimate dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MQINPNKDTQLCMSLSGRPGNFGLRFHNHLYEQLGLNFYYKAFSSQDLPGAVGGIRALGI
RGCGVSMPFKEACIALVDELDPSAAAIQSINTIVNTNGHLKAYNTDYIAIAQLLQSHAVP
QDSTFALRGSGGMAKAVASALRDGGYRNGLIVARNEATGRALAESLGYEWQAELGARRPQ
MLINVTPIGMTGGPEADQLAFEPETIAAAETVFDVVAIPSETPLIVRARAEGKRVITGLE
VIAIQALEQFVLYTGVRPNLEQFEKAVAFARSA