Protein Info for AO356_01615 in Pseudomonas fluorescens FW300-N2C3

Annotation: cytochrome B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 7 to 176 (170 residues), 107.7 bits, see alignment E=3e-35

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a1838)

Predicted SEED Role

"Cytochrome B561, bacterial precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W2P4 at UniProt or InterPro

Protein Sequence (178 amino acids)

>AO356_01615 cytochrome B (Pseudomonas fluorescens FW300-N2C3)
MSAPRHFAPLARLLHWLMALMIIAMLFIGAGMVASVSARHEWLLQLHKPLGIAILLLVIV
RLVVRFTTRQPPLPADLPGWQVLAANVSHVLLYALMLVLPLLGWGMISAAGDPVMLGNWL
QLPSILPAHAQTFALLRKAHGYLAYLLFLTVLVHLAAALFHAWVRRDEVLDSMLRGKG