Protein Info for AO356_01610 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF18027: Pepdidase_M14_N" amino acids 10 to 117 (108 residues), 124.5 bits, see alignment E=2e-40 PF00246: Peptidase_M14" amino acids 132 to 267 (136 residues), 71.8 bits, see alignment E=7.6e-24

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a1839)

Predicted SEED Role

"Predicted carboxypeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQ04 at UniProt or InterPro

Protein Sequence (383 amino acids)

>AO356_01610 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
VTVAKSSFDISANFDSGNIEVVDISNPLQSLLKIRPDTRSAHFQWFHFKASGLHVGQEYS
FRLLNASQSSYNKAWTGYQTVASYDHVNWFRIPTQFEGDALRFHLEAEQPHAWFAYFEPY
SRGRHDWLIEQAQHKAGTELLAVGKSVEGRDIQLLRKGNGAEGRRKIWIIAQQHPGEHMA
EWFMEGVIERLQQHDDGQLNRLLAKADLYLVPNMNPDGAFHGHLRTNAMGQDLNRAWQNA
SPEISPEVFFVQQQMEKYGVDLFLDAHGDEEIPHVFTAGCEGNPGYTPRIAELEERFRSH
LKHQTKDFQTAHGYTRDEPGQANMTLACNAVGQKYDCLSLTLEMPFKDHDDHPNPITGWS
GKRSMQLGKDVLSTIEAMVDQLR