Protein Info for AO356_01580 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (RXN0-2301) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: isovaleryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF02771: Acyl-CoA_dh_N" amino acids 13 to 123 (111 residues), 141.9 bits, see alignment E=2.1e-45 PF02770: Acyl-CoA_dh_M" amino acids 127 to 222 (96 residues), 95.6 bits, see alignment E=3.3e-31 PF00441: Acyl-CoA_dh_1" amino acids 234 to 382 (149 residues), 144.5 bits, see alignment E=5.9e-46 PF08028: Acyl-CoA_dh_2" amino acids 256 to 365 (110 residues), 49.5 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 65% identical to IVD_SOLTU: Isovaleryl-CoA dehydrogenase, mitochondrial (IVD) from Solanum tuberosum

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a1845)

MetaCyc: 88% identical to isovaleryl-CoA dehydrogenase subunit (Pseudomonas aeruginosa PAO1)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.4

Use Curated BLAST to search for 1.3.8.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1C1 at UniProt or InterPro

Protein Sequence (387 amino acids)

>AO356_01580 Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (Pseudomonas fluorescens FW300-N2C3)
MSYPSLNFALGETIDMLRDQVQAFVKAELAPRAAQIDIDNLFPADMWRKFGDMGLLGITV
PEEYGGAGLGYLAHVVAMEEISRGSASVALSYGAHSNLCVNQINRNGNHEQKTKYLPKLI
SGEHIGALAMSEPNAGSDVVSMKLRADKRGDHYVLNGSKTWITNGPDANTYVIYAKTDLE
KGPHGITAFIVERDWKGFSRSNKFDKLGMRGSNTCELFFDDVEVPEENILGALNGGVKVL
MSGLDYERVVLSGGPTGIMQACMDLIVPYIHDRKQFGQSIGEFQLIQGKVADMYTQLNAS
RAYLYAVAQACERGETTRKDAAGVILYSAERATQMALDAIQILGGNGYINEFPAGRLLRD
AKLYEIGAGTSEIRRMLIGRELFNETR