Protein Info for AO356_01340 in Pseudomonas fluorescens FW300-N2C3

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 54 to 73 (20 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details PF04403: PqiA" amino acids 52 to 206 (155 residues), 176.5 bits, see alignment E=1.7e-56

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 98% identity to pba:PSEBR_a1882)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W2P6 at UniProt or InterPro

Protein Sequence (219 amino acids)

>AO356_01340 paraquat-inducible protein A (Pseudomonas fluorescens FW300-N2C3)
MNGQPQDTPPEARDLDLCLCHSCGLACDMAGGPQTCPRCDAALHRRKPDAITRTWAYMLA
ALVFYIPANLLPVMNTQMLGEGADSTIISGVIEFWQSGAWDIALIIFIASIAVPGIKFVV
LTLLLVTVQRRSTWAQVQRAKLYRLVEVIGYWSMLDVLVVALVAALVKFQALSDIEPRPG
ILFFGLVVLFTMLSAMSFDPRLIWDTQPSEEVMDEVASH