Protein Info for AO356_01235 in Pseudomonas fluorescens FW300-N2C3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 320 to 336 (17 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 394 (363 residues), 170.2 bits, see alignment E=6.3e-54

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1902)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKT8 at UniProt or InterPro

Protein Sequence (449 amino acids)

>AO356_01235 MFS transporter (Pseudomonas fluorescens FW300-N2C3)
VNTSSLKANAGADPVLLSAIAKVKRHILPLFVIMFIVNYIDRVNIGFVRAHMEHDLGIGA
AAYGFGAGLFFIGYALFEVPSNILLQRIGARIWLTRIMLTWGLVAAAMAFIQNETHFYIL
RFLLGVAEAGFFPGVIYYFTRWLPGVERGKAIAIFLSGSAIASLISGPLSGLLLQINGLG
MHGWQWMYFIEGMFSVCLCVFVWFWLDSKPHDAKWLSREEQDVLVKAIDDEQRAREAASP
IKLSIGQLLKDRQIILFCLIYFFIQLTIYAATFWLPSIIKKMGELSDIQVGLFNSIPWLL
SIVGMYAFASLSAKWKFQQAWVATALLIAAAGMFMSTTGGPIFAFVAICFAALGFKSASS
LFWPIPQAYLDARIAAGVIALINSVGNLGGFVAPTTFGLLEEHTGSIQGGLYGLAATSII
AAIIVFAARNTPKPKAVTTTPVDPAASHV