Protein Info for AO356_01105 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): putative hydrolase, required for lysine catabolism
Rationale: PFam PF07063.9 (DUF1338). This gene is specifically important for utilizing lysine, and this phenotype is conserved. It might be the decarboxylating 2-oxoadipate hydrolase of the D-lysine oxidase pathway, which has not been linked to a gene, or the crotonyl-CoA hydratase in the glutaryl-CoA degradation pathway.
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21723: DUF1338_N
  • amino acids 9 to 190 (182 residues), 199.9 bits, E=3.1e-63
• PF07063: DUF1338
  • amino acids 195 to 409 (215 residues), 223.3 bits, E=2.3e-70

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a3739)

MetaCyc: 69% identical to 2-oxoadipate dioxygenase/decarboxylase (Pseudomonas putida KT2440)
RXN-21282 [EC: 1.13.11.93]

Predicted SEED Role

"FIG00960493: hypothetical protein"

MetaCyc Pathways

• L-lysine degradation V (6/9 steps found)
• superpathway of L-lysine degradation (19/43 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.93

Sequence Analysis Tools

See A0A0N9W2K6 at UniProt or InterPro

Protein Sequence (458 amino acids)

>AO356_01105 putative hydrolase, required for lysine catabolism (Pseudomonas fluorescens FW300-N2C3)
MSFVSPDLIRQRFSRAMSDMYRDEVPLYGALMKLVEHTNAQVLSEQPQLAEHLRSTGELE
RLDLERHGAIRVGTAAELATLGRLFAVMGMQPVGYYDLTPAGVPVHSTAFRAVHESALQV
SPFRVFTSLLRLELIENSELRAFAESVLAKRQIFTPGALALIDLAERQGGLTQAQAEDFV
LQALETFRWHHSATVTAEQYRQLSAQHRLIADVVAFKGPHINHLTPRTLDIDIVQARMPV
HGITPKAVIEGPPRRQCPILLRQTSFKALDEPVAFTDQPQAQGSHSARFGEIEQRGAALT
PKGRALYDQLLNAARDALGAFPNEANAERYNALMTEHFVAFPDNHDELRQQALAYFRYFP
TPKGLAAKGTLEPAASLEHLLEQQYLRAEPLVYEDFLPVSAAGIFQSNLGDAAQSHYAGQ
SNRQAFEAALGRATIDELGLYAQTQQRSIDECRAALGV