Protein Info for AO356_00450 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): D-glucosaminate dehydratase (EC 4.3.1.9)
Rationale: Specifically important for: D-Glucosamine Hydrochloride. This enzyme had not previously been linked to a gene. This is the second step in catabolism of glucosamine, and the 'beta' form of the enzyme was expected to be PLP-dependent and about this size. Iwamoto et al (2003) purified a non-specific 'alpha' enzyme for this reaction (PMID: 12686150)
Original annotation: amino acid deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF01168: Ala_racemase_N" amino acids 33 to 217 (185 residues), 39.2 bits, see alignment E=6.5e-14 PF14031: D-ser_dehydrat" amino acids 292 to 388 (97 residues), 61.4 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a1964)

MetaCyc: 85% identical to glucosaminate ammonia-lyase (Pseudomonas simiae)
Glucosaminate ammonia-lyase. [EC: 4.3.1.9]

Predicted SEED Role

"D-serine deaminase (EC 4.3.1.18)" (EC 4.3.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.18 or 4.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKE9 at UniProt or InterPro

Protein Sequence (405 amino acids)

>AO356_00450 D-glucosaminate dehydratase (EC 4.3.1.9) (Pseudomonas fluorescens FW300-N2C3)
MSSVIPNAGVEKGAATVGAHLLKDVSLPALVLHRAALEHNIRWMQAFVTDSGAELAPHGK
TSMTPALFRRQLDAGAWGLTLATAVQTRAAYAHGVRRVLMANQLVGTPNMALIADLLADP
AFEFHCMVDHPDNVADLGAFFASRGMKLNVMIEYGVVGGRCGCRTEAEVLALAEAIRSQP
ALALTGIEGYEGVIHGDHAISGIRAFAASLVRLAVQLQDDDAFAIDKPIITASGSAWYDL
IAESFEAQNAHGRFLSVLRPGSYVAHDHGIYKEAQCCVLERRSDLHEGLRPALEVWAHVQ
SLPEPGFAVIALGKRDVAYDAGLPVPLKRYTPGSDSVPGDDVSGCKVTAVMDQHAFMSVA
AGVELRVGDIIAFGTSHPCLTFDKWRVGCLVDEQLRVVESMETCF