Protein Info for AO356_00300 in Pseudomonas fluorescens FW300-N2C3

Annotation: relaxase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 TIGR03760: integrating conjugative element relaxase, PFGI-1 class" amino acids 22 to 239 (218 residues), 296.4 bits, see alignment E=6.3e-93 PF07514: TraI_2" amino acids 23 to 335 (313 residues), 400.6 bits, see alignment E=4.7e-124 PF07515: TraI_2_C" amino acids 450 to 570 (121 residues), 141 bits, see alignment E=1.9e-45

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfs:PFLU1915)

Predicted SEED Role

"FIG00959090: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X3C5 at UniProt or InterPro

Protein Sequence (574 amino acids)

>AO356_00300 relaxase (Pseudomonas fluorescens FW300-N2C3)
MFSLYRHKRRKPSPPPTVNVAEGYLPIESAHSLLAAEHRRQLLDRIWQYTALSHAQFIQL
YLNPIHRYAEQVQQLPASETHHHAYLGGMLDHGLELVACSLKLRQSYLLPTGYAPEDQAA
QTDAWSAGIAYGALLHDIGKIAVDLLVERQDGRVWHPWQGSLDQPYRFRYIKGRDYHLHS
AAAGLLYTQILDRPTLDWLSGFPPLWASLLYVLAGQYERAGVLGELVMQADRVSTAQNIG
GNPSKALQAPTHSLQHHLISGLRYLVQHELKLNQPGAAGWLTRDALWLVSKTVTDKLRAY
LLSQSIEGIPSSNLAVFDELQSHGLVESTPEGKAIWTALVAQGNWQQSFTFLRLQPVLIW
GNEDRPEAFSGTVNITAHDHPTDAPVSLSAPKAGGTGSHQSQSQPDPMAMEDADYLGTLL
DMFEMGEPEPSETSSENVLEVSSPPSDDPGQVFLNWVKEGIQNQKLIINDSKAKIHTVCG
SVILVTPGLFQRYAQEFPGISQGADQEIEEWRWVQKQFEKLKVHRKREDGLNIWICQVEG
PRKKANLKGYLLETPELLFNIVPADNPFLKIVNA