Protein Info for AO356_00025 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): ABC transporter for D-Sorbitol, periplasmic substrate-binding component
Rationale: Specific phenotype on D-Sorbitol.
Original annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 43 to 326 (284 residues), 208 bits, see alignment E=3.6e-65 PF13416: SBP_bac_8" amino acids 43 to 337 (295 residues), 97.1 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a2024)

MetaCyc: 74% identical to polyol ABC-type transporter periplasmic substrate-binding protein (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, periplasmic substrate-binding protein" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WC97 at UniProt or InterPro

Protein Sequence (436 amino acids)

>AO356_00025 ABC transporter for D-Sorbitol, periplasmic substrate-binding component (Pseudomonas fluorescens FW300-N2C3)
MKITNALILSTGLSFALASHAAETLTIATVNNGDMIRMQRLSKVFEQQHPDIKLNWVVLE
ENVLRQRLTTDIATQGGQFDVLTIGTYETPMWGAKNWLEPMKDLPAGYDVDDIFPAVRQG
LSVNDTLYALPFYGESTITYYRTDLFKAAGLTMPGQPTWSQLGEFAAKLNDPSKDQYGMC
LRGKAGWGENMALLTTMANAFGARWFDEKWQPELNGPEWKAAATFYVDTLKKYGPPGVSS
NGFNETLALFNSGKCAIWVDASVAGSFTTDKEQSRVVDSVGFAPAPIEVTDKGSSWLYAW
SLAIPATSKHKEAAKSFVTWATSKEYIQLVTDKDGITNVPPGTRISTYSDAYLKAAPFAQ
VTLQMMKHADPSQPSAKPVPYVGIQYVVIPEFQSIGTSVGKLFSAALTGQMSVEQALASA
QSTTEREMKRAGYPKK