Protein Info for AO353_29305 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)
Rationale: Specifically important for: Putrescine Dihydrochloride. part of the gamma-glutamyl-putrescine pathway for degrading putrescine (SEED_correct)
Original annotation: gamma-glutamyl-gamma-aminobutyrate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 5 to 223 (219 residues), 249.3 bits, E=3.7e-78
• PF00117: GATase
  • amino acids 50 to 224 (175 residues), 51 bits, E=1.5e-17

Best Hits

Swiss-Prot: 47% identical to PUUD_ECO57: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Escherichia coli O157:H7

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 89% identity to pfo:Pfl01_2121)

MetaCyc: 46% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
• superpathway of ornithine degradation (7/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)
• putrescine degradation II (3/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

See A0A0N9WJH3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>AO353_29305 Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (Pseudomonas fluorescens FW300-N2E3)
MALKPLIGVTACVKQIGLHPYHVSGDKYLRAVSVAALGLPVVIPSLGELTEIDELLAHLD
GLLLTGSPSNVEPFHYQGPASAPGTDHDPARDSTTLPLLRAAIAAGVPVLGICRGFQEMN
VAFGGSLHQKVHELPGMLDHREADHPDLAVQYAPAHAVSVQPGGVFQALELPPVFQVNSI
HSQGIDRLAPGLRAEAIAPDGLIEAISVEHSKAFALGVQWHPEWQVLANPPYLSIFQAFG
DACRQRAALRNTR