Protein Info for AO353_29285 in Pseudomonas fluorescens FW300-N2E3

Annotation: XRE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF13560: HTH_31" amino acids 4 to 51 (48 residues), 30.4 bits, see alignment E=7.9e-11 PF01381: HTH_3" amino acids 7 to 60 (54 residues), 46 bits, see alignment E=8.9e-16 PF13443: HTH_26" amino acids 7 to 65 (59 residues), 24.4 bits, see alignment E=5.7e-09 PF07883: Cupin_2" amino acids 107 to 175 (69 residues), 57.9 bits, see alignment E=1.3e-19

Best Hits

Swiss-Prot: 39% identical to PUUR_ECOLI: HTH-type transcriptional regulator PuuR (puuR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_2125)

Predicted SEED Role

"Putrescine utilization regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W1E3 at UniProt or InterPro

Protein Sequence (182 amino acids)

>AO353_29285 XRE family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MDTGSRLKLVRESYKLSQRELARRSGVTNATISLIEQNRVSPSVSSLKKLLESIPMSLAD
FFTFDQPPQEHKYVFRANEQPDLGRDGLRLLLIGASVPSRQMRLLREQYAPGASSGEEPI
VHVEGEECGLVTRGTVELTVDGQISVLNAGDGYYFPTTLPHRFRNIGADEAEIISANTPA
NF