Protein Info for AO353_29225 in Pseudomonas fluorescens FW300-N2E3

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00702: Hydrolase" amino acids 8 to 183 (176 residues), 71.3 bits, see alignment E=3e-23 PF13419: HAD_2" amino acids 10 to 189 (180 residues), 117 bits, see alignment E=2.2e-37 PF12710: HAD" amino acids 10 to 180 (171 residues), 39.9 bits, see alignment E=1.3e-13 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 106 to 183 (78 residues), 25.4 bits, see alignment E=1.6e-09 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 145 to 186 (42 residues), 29.4 bits, see alignment 8e-11 PF13242: Hydrolase_like" amino acids 146 to 209 (64 residues), 37.5 bits, see alignment E=3.6e-13

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 55% identity to pen:PSEEN0963)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WS00 at UniProt or InterPro

Protein Sequence (238 amino acids)

>AO353_29225 hydrolase (Pseudomonas fluorescens FW300-N2E3)
MASRLRVEAVLFDLDGTLVDTLPDITWCLNQVLLEHGCPVLTAQTVRGYIGGGTTAMIER
VAAQFGIADAIALHQRYVTLYQHNLVQFSRPFSGVLELLEGCRQLQLPLAIVTNKAEEMA
LQVSRTLLPQNVFGPILGHRTGRSLKPQPDVAWEAARRLSVDPQRCLFVGDTEIDLKTAR
AAGMYSAAVTWGYGLTQTLQALAPDFCCEQPAGLLRILQQVCGTAHALTEHGDTVKSY