Protein Info for AO353_29100 in Pseudomonas fluorescens FW300-N2E3

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF13508: Acetyltransf_7" amino acids 70 to 147 (78 residues), 31.5 bits, see alignment E=1.9e-11 PF00583: Acetyltransf_1" amino acids 71 to 145 (75 residues), 28.9 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 70% identity to pfl:PFL_2428)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WR88 at UniProt or InterPro

Protein Sequence (226 amino acids)

>AO353_29100 GNAT family acetyltransferase (Pseudomonas fluorescens FW300-N2E3)
MFTITHFEAPCSETINDQILQMVVDYLTDISTVAIAPSNLLFNVYQYAIGYEVHLYLQAL
DGSKGIAVELIVAVDDEDPSKVIGFLLYLPVKDDPEACGVAYMAVQASHRHQGVARAMVQ
EMLSRYPHAELACAVGKVACFEAMGFQVLGTRGPQVLMNTRDHSTGGLMGVLDTAPIYRS
TEVRQIHTYLLQRHGKRAMLDAEKQRDRHLDQMTAKAKAFVQERLG