Protein Info for AO353_28705 in Pseudomonas fluorescens FW300-N2E3

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF03358: FMN_red" amino acids 3 to 141 (139 residues), 42.1 bits, see alignment E=6.7e-15 PF02525: Flavodoxin_2" amino acids 3 to 179 (177 residues), 144.6 bits, see alignment E=3.2e-46

Best Hits

Swiss-Prot: 70% identical to AZOR_GRABC: FMN-dependent NADH-azoreductase (azoR) from Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 70% identity to gbe:GbCGDNIH1_1054)

Predicted SEED Role

"FMN-dependent NADH-azoreductase (EC 1.7.-.-)" (EC 1.7.-.-)

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W151 at UniProt or InterPro

Protein Sequence (204 amino acids)

>AO353_28705 FMN-dependent NADH-azoreductase (Pseudomonas fluorescens FW300-N2E3)
MSRLLTIETSPRGDASISRQLTRRFVAAWEAAHPSGAIKIRDLTETSLTFVTAPWLQAYF
TPQTQHSPEMKAVLQLSDELVAELLETDHLVISTPVYNYNVPAALKAWVDHVVRKGLTLG
FDGKGLVTGKKATVLLASGGVYTNDSPIRDRDIATQYLKLILNVLGITDVTFITAGGAKA
VDLGDIGMRDFLDTFDHQIQKSLV