Protein Info for AO353_28465 in Pseudomonas fluorescens FW300-N2E3

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 43 to 359 (317 residues), 34.2 bits, see alignment E=3.9e-12 PF13533: Biotin_lipoyl_2" amino acids 67 to 114 (48 residues), 58.6 bits, see alignment 8.3e-20 PF16576: HlyD_D23" amino acids 230 to 309 (80 residues), 63.4 bits, see alignment E=3.7e-21 PF13437: HlyD_3" amino acids 233 to 316 (84 residues), 60.4 bits, see alignment E=5.1e-20

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 73% identity to rhi:NGR_b21350)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VVH8 at UniProt or InterPro

Protein Sequence (365 amino acids)

>AO353_28465 multidrug transporter (Pseudomonas fluorescens FW300-N2E3)
MNSLQDTAAIATGAIAGPPVVVARRSTRKTIGILLCVGAVVVVAAWGTMAVSSGTTSTDN
AYVRGDVTSLAAKVAGYVTAVEVVDNQTVRAGDVLFRIDDRDFRAKLAQAEANVSAAKAR
LTHVDAQTQLQRALIRQAEAQRRSASADMDLATKTHDRSRKLIASNAVSQALFDETGTAR
SRAEASVSAASATVEAQQQHIAVYVAEREAAVAAVSQAQAARDLAQIDLDYTVVRAPVDG
VVGNRQVRVGRLVTPGVSLLDIVPVNDVWVVANFKETQLEHIRPGQRVRITVDGYPNTAL
EGVVDSFAPGSGAAFSLLPPDNATGNFVRVVQRVPVKIRLADNPLPGRIVPGLSARVEVT
QGGGS