Protein Info for AO353_28135 in Pseudomonas fluorescens FW300-N2E3

Annotation: nickel permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 120 (109 residues), 61.9 bits, see alignment E=3.5e-21 PF00528: BPD_transp_1" amino acids 31 to 224 (194 residues), 64 bits, see alignment E=7.9e-22

Best Hits

Swiss-Prot: 36% identical to HISM_ECOLI: Histidine transport system permease protein HisM (hisM) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 63% identity to pfl:PFL_5023)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WK76 at UniProt or InterPro

Protein Sequence (232 amino acids)

>AO353_28135 nickel permease (Pseudomonas fluorescens FW300-N2E3)
MIPAWIVEYAALLGRGLQTSITLLLFASAFGFVLAVLVALARISKNNVIAKASLFYTSVF
RGTPLLIQIYIFYYGLGSLFAQFPLIRGSFLWPYLRDGYWYIVFALVLSVGAYVGEVIRG
GLLAVPKGEMEAASAFGMTPRQSLLRVRLPRAMRLLLPTLAGETVMLLKSTALASTIAVI
DLLGAANVVRAQTLQVYQPLLLVAGVYVCLTFLIEALFAFAERRGTPLRRAV