Protein Info for AO353_28105 in Pseudomonas fluorescens FW300-N2E3

Annotation: hemolysin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 72 to 118 (47 residues), 56.2 bits, see alignment 5.6e-19 PF13437: HlyD_3" amino acids 74 to 135 (62 residues), 22.7 bits, see alignment E=3.4e-08 amino acids 230 to 311 (82 residues), 52 bits, see alignment E=2.6e-17 PF00529: CusB_dom_1" amino acids 168 to 359 (192 residues), 26.9 bits, see alignment E=9.3e-10 PF16576: HlyD_D23" amino acids 217 to 307 (91 residues), 50.5 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 69% identity to bja:bll6258)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W0D9 at UniProt or InterPro

Protein Sequence (379 amino acids)

>AO353_28105 hemolysin D (Pseudomonas fluorescens FW300-N2E3)
MTRQFDIPASQTFEHPGPNQADRPIKKPFKEKLRPLLMVGVPALVAAVGYSHYVTGEPYV
STDNAYARVAKASINARVSGQVVEIAVEDNQPVRKGQVLFRINPEPFQIAINRAEAQLSV
ARLRIDGLKASYRQQQAELQSAKESADFDQREFARKKALVATEFVSRAIYERADTDLKVA
RQRIASIEQQIASTVVALNGNPDIEADKHPMVREAKAQLDEAQLYLSYATVYAPQDGIVA
KVDDLQVGNYVNSGAPAFALLSDRQIWVEANFRETEVTHMRRGQEATISVDTYPDHVFKA
HVTSMSPGAGSDFALLPPENATGNWVKVVQRVPVRLELDEVDPALPLFSGTSATVKVDTG
YRTPWWHPLKALLTAGTDR