Protein Info for AO353_27980 in Pseudomonas fluorescens FW300-N2E3

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 17 to 42 (26 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 115 (105 residues), 72.8 bits, see alignment E=1.3e-24 PF00528: BPD_transp_1" amino acids 32 to 220 (189 residues), 55.9 bits, see alignment E=2.5e-19

Best Hits

Swiss-Prot: 51% identical to OCCM_RHIML: Octopine transport system permease protein OccM (occM) from Rhizobium meliloti

KEGG orthology group: K10023, arginine/ornithine transport system permease protein (inferred from 88% identity to pen:PSEEN3282)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMU9 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AO353_27980 amino acid ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MLDYNLIWENLPLYFSGALLTLKVLLISLAFGLMLAIPLALMRVSRSPLINFPAWLYTYA
IRGTPMLVQLFLIYYGLAQFEAVRQSVLWPYLSSATFCACLAFAINTSAYSAELLAGSLK
STPNGEIEAAKAMGMSRLTLYRRILLPSALRRALPQYSNEVLMMLQTTSLASIVTLVDIT
GAARTVSSRFYLPFEAFITAGLIYLALTFILVRLFKLAERHWLAYLAPRKH