Protein Info for AO353_27720 in Pseudomonas fluorescens FW300-N2E3

Annotation: cupin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF08007: JmjC_2" amino acids 104 to 219 (116 residues), 146.1 bits, see alignment E=4.1e-47 PF20514: ROXA-like_wH" amino acids 266 to 383 (118 residues), 110.7 bits, see alignment E=4.4e-36

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a3577)

Predicted SEED Role

"FIG002776: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VV33 at UniProt or InterPro

Protein Sequence (388 amino acids)

>AO353_27720 cupin (Pseudomonas fluorescens FW300-N2E3)
MNPDTPLQLLGGITAREFLRDYWQKKPLLIRQAIPDFESPIDADELAGLALEEEVESRLV
IEHGERPWELRRGPFAEDEFSKLPEREWTLLVQAVDQFVPEVAELLENFRFLPSWRIDDV
MISFAAPGGSVGPHFDNYDVFLLQGHGKRNWKIGQMCDSDSPLLQHADLRILADFEATDE
WTLEPGDMLYLPPRLAHCGVAVDDCMTYSVGFRAPSAAEVLTHFTDFLSQFLPDEERYTD
ADAQPAIDPHQIQHDALDRLKSLLAEHMSDERLLLTWFGQFMTEPRYPELVVGPELEEDD
LLSSLEQGAVLIRNPSARLAWSEVDDDLLLFASGQSRYLPGKLRELLKMICAADALHVDN
LGQWLSDEDGRNLLCELVKQGSLGFADE