Protein Info for AO353_27680 in Pseudomonas fluorescens FW300-N2E3

Annotation: ATP-dependent Clp protease adaptor ClpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF02617: ClpS" amino acids 37 to 115 (79 residues), 121.5 bits, see alignment E=5.3e-40

Best Hits

Swiss-Prot: 98% identical to CLPS_PSEF5: ATP-dependent Clp protease adapter protein ClpS (clpS) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 98% identity to pfl:PFL_3886)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMQ0 at UniProt or InterPro

Protein Sequence (120 amino acids)

>AO353_27680 ATP-dependent Clp protease adaptor ClpS (Pseudomonas fluorescens FW300-N2E3)
MHAISQIRLTFNQDRPDLHDDDSAGIAVQEAKPALQAPPMYKVVLFNDDYTPMDFVVEVL
EVFFNLNRELATKVMLAVHTEGRAVCGVFTRDIAETKAMQVNQYARESQHPLLCEIEKDG