Protein Info for AO353_27635 in Pseudomonas fluorescens FW300-N2E3

Annotation: camphor resistance protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 6 to 19 (14 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details TIGR00494: protein CrcB" amino acids 7 to 121 (115 residues), 86.4 bits, see alignment E=9.4e-29 PF02537: CRCB" amino acids 7 to 119 (113 residues), 100.6 bits, see alignment E=2.9e-33

Best Hits

Swiss-Prot: 94% identical to CRCB_PSEPF: Putative fluoride ion transporter CrcB (crcB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K06199, CrcB protein (inferred from 94% identity to pfo:Pfl01_3583)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQC1 at UniProt or InterPro

Protein Sequence (124 amino acids)

>AO353_27635 camphor resistance protein CrcB (Pseudomonas fluorescens FW300-N2E3)
LIPLIVAVSVGGIAGTLLRFATGNWINANWPRHFYTATLAVNIIGCLLIGFLYGLFMLRP
EVPIEVRAGLMVGFLGGLTTFSSFSLDTVRLLESGQVPLALGYAAISVFGGLLATWAGLS
LTKL