Protein Info for AO353_27390 in Pseudomonas fluorescens FW300-N2E3

Annotation: conjugal transfer protein TraC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 PF13362: Toprim_3" amino acids 202 to 307 (106 residues), 29.7 bits, see alignment E=1.1e-10 PF05272: VapE-like_dom" amino acids 429 to 640 (212 residues), 271.7 bits, see alignment E=5.9e-85 PF19263: DUF5906" amino acids 484 to 588 (105 residues), 30 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K06919, putative DNA primase/helicase (inferred from 85% identity to pst:PSPTO_3418)

Predicted SEED Role

"DNA primase, phage associated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPE2 at UniProt or InterPro

Protein Sequence (738 amino acids)

>AO353_27390 conjugal transfer protein TraC (Pseudomonas fluorescens FW300-N2E3)
MLDEVLGQFADYGLEPAQPLVFGKLTRCKTTQDKGKEKNGWYVVHEHLTEKNETLIFGSF
GDWRSGETQKIKVKAGRMSPEEREVMRARQEDAKRRAAEIASNAARRAAKRAEGLFERMP
TTGRSDYLDRKQIVGIKVRYAPRTGAVLVPMKNARDQIMGLQVIFPYKQEDTGRDKSYWP
YGMAKEGAFHLLGPHPEPGEPVLVCEGYATGASLHMATSLAVAVAFDAGNLLAVCKAMRE
RFAGCPLIICRDDDWKTKKPNGDAWNPGEEKASNAALIVGAQVVAPIFSVERQDKWTDFN
DLHVAEGLEAVRRQVLAVVRPPAAGGWKDQLARSESGALIAHMQNVELILANDERWAGVI
SYSAFSSKIVKLRAAPYGGGTGDWADIDDMRVMKWLAQQYNLRVKASHVIEAVSVVAHDH
AFHPVRQYLQKLDWDRVPRLETWLTDVMGVKESEYTSKVGKRWMLSAVARVMKPGCKADS
VMILEGAQGAGKSTAMSILGGEWFMDTPFALGDKDGFQAIRGKWIVELGELDSFNKAEST
KAKQFFSASTDTYRESYGRRTMDVPRQCVFVGTTNQDEYLKDATGNRRYWPVACTKVDLE
LLRSIRDQLWAEAMFCYDAGDLWWVTLDEAAMFGEEQDERFVVDEWEGPILTWLEESQIG
ETTTGSEVLASALKLDYGHWSKPEQIRVGAIMHRLGWRRVRLPALAKSGQRPWAYKKPAG
WGGASALQREAFEEPCFD