Protein Info for AO353_26910 in Pseudomonas fluorescens FW300-N2E3

Annotation: MFS transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 22 to 39 (18 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 374 to 399 (26 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 396 (367 residues), 156.5 bits, see alignment E=4.6e-50

Best Hits

Swiss-Prot: 44% identical to TUB4_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 93% identity to pfo:Pfl01_2910)

Predicted SEED Role

"D-glycerate transporter (predicted)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VUW1 at UniProt or InterPro

Protein Sequence (436 amino acids)

>AO353_26910 MFS transporter permease (Pseudomonas fluorescens FW300-N2E3)
MSQSAAATLATDDDKNAVYKRVTLRLIPFIFVCYLFNYLDRVNVGFAKLQMLDALKFSET
VYGLGAGIFFIGYVLCGVPSNLALTRFGPRRWIALMMVTWGMLSTCLLFVTTPTGFYTLR
LFTGAAEAGFFPGVVLYLSQWFPTFRRGRIMALFMSAIPVSGLLGSPFSGWILNHFAAGQ
GGLAGWQWMFLLQGIPTITLGALAFFLLSDNFASAKWLKPEERAVLEADQAIDWASKPKT
ATDSLLAVFKNPAIWAFGLIYFCIQSGVYAINFWLPSIIKNLGFADNLVIGWLSAIPYLL
AAVFMLMVGRSADLHKERRWHLVVPMLMGAVGLLIAVNFAANPAIAILGLTIATMGALTG
LPMFWPVPTAMLSAGAAAGGLALINSMGQMAGFLSPYLVGWVKDSTGSTDAALYLLAGVI
VCGSLLALRMTRTLRA