Protein Info for AO353_26795 in Pseudomonas fluorescens FW300-N2E3

Annotation: NAD-dependent deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 27 to 227 (201 residues), 147.5 bits, E=2.1e-47

Best Hits

Swiss-Prot: 71% identical to NPD3_PSESM: NAD-dependent protein deacetylase 3 (cobB3) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01463, [EC: 3.5.1.-] (inferred from 82% identity to pfo:Pfl01_2078)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

See A0A0N9WMB7 at UniProt or InterPro

Protein Sequence (287 amino acids)

>AO353_26795 NAD-dependent deacetylase (Pseudomonas fluorescens FW300-N2E3)
MFESPIREQLDYLQNLMAEQPLLVLTGAGISTASGIPDYRDTDGVRRGRQPMMYQEFLKA
PESRQRYWARAMLGWPRVRQARPNTAHKALATLQAQRQIAGLITQNVDTLHDQAGSPDVI
ELHGSLHRVLCLDCGQRSDRDSIQRLMEAQNPYLAGVDAVQAPDGDTLLDPAFESHFQVP
RCPNCEGERMKPDVVFFGENVAHATAAKAMAAAEQAAGLLVVGSSLMAFSAFRLCRVIAD
RGKPLIAINLGKTRADALLDMKIEASCEQLLPLLAERLSRLRPFLPV