Protein Info for AO353_26730 in Pseudomonas fluorescens FW300-N2E3

Annotation: DNA alkylation repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF08713: DNA_alkylation" amino acids 118 to 220 (103 residues), 24.8 bits, see alignment E=8e-10

Best Hits

Swiss-Prot: 42% identical to YHAZ_BACSU: Uncharacterized protein YhaZ (yhaZ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 74% identity to pba:PSEBR_a3391)

Predicted SEED Role

"DNA alkylation repair enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WAV7 at UniProt or InterPro

Protein Sequence (367 amino acids)

>AO353_26730 DNA alkylation repair protein (Pseudomonas fluorescens FW300-N2E3)
MSSTDQSSPALKEIFNAERLQHIASEMHAVYPAFNARAFLKLANEGLAELSVMQRMARVG
ECLHAVLPLSYEQTLEILRPLAPRLNSGFVSMFLPQYVATYGAHAFELSMDALKYFTTFG
SSEFAIRHFLRSDFERSLALMHDWSLDDNEHVRRLASEGSRPRLPWSFRLEPVQADPTLA
AVILDNLKADSSLYVRKSVANHLNDITKDHPEWVLSLIEGWSLEDPRTAWIAKHALRSLI
KQGNQRALAIIGAGGKPEVEIHNLKVEPPVISLGETIKLSFDLHSTANDNQRLVVDYAID
YVKASGATSAKVFKLKGLTLPAHARQTLSRTQQIRELTTRKHYAGTHAVHIMINGERLGS
TAFEITP