Protein Info for AO353_26645 in Pseudomonas fluorescens FW300-N2E3

Annotation: branched-chain alpha-keto acid dehydrogenase subunit E2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF00364: Biotin_lipoyl" amino acids 5 to 77 (73 residues), 56.6 bits, see alignment E=2.9e-19 PF02817: E3_binding" amino acids 138 to 173 (36 residues), 45.6 bits, see alignment 9.7e-16 PF00198: 2-oxoacid_dh" amino acids 194 to 423 (230 residues), 274.9 bits, see alignment E=7.9e-86

Best Hits

Swiss-Prot: 73% identical to ODB2_PSEPU: Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (bkdB) from Pseudomonas putida

KEGG orthology group: K09699, 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC: 2.3.1.168] (inferred from 88% identity to pfo:Pfl01_3465)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.168

Use Curated BLAST to search for 2.3.1.168

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQX8 at UniProt or InterPro

Protein Sequence (425 amino acids)

>AO353_26645 branched-chain alpha-keto acid dehydrogenase subunit E2 (Pseudomonas fluorescens FW300-N2E3)
MGTHVIKMPDIGEGIAEVELSVWHVKVGDMVVEDQVLADVMTDKAMVDIPSPVHGKVISL
GGEPGEVMAVGSILISIEVEGEGNVKASSQPAPAAPAPKPAPVAAPKVEAAIESKSAVPA
RPVAPQGPMIAREADERPLASPAVRKHALDAGIQLRLVRGTGPAGRILHEDLEAYLAQGQ
SNASSTVAAYAERNDEQQIPVIGMRRKIAQRMQDATQRAAHFSYVEEIDVTAVEELRAHL
NEKHGATRGKLTLLPFLVRAMVVALRDFPQINARYDDEAQVITRLGAVHVGVATQSDIGL
MVPVVRHAEARSLWDSAAEISRLATAARNGKASRDELSGSTITLTSLGALGGIVSTPVLN
LPEVAIVGVNKIVERPMVIKGQIVIRKMMNLSSSFDHRVVDGMDAAQFIQAIRGLLEQPA
TLFVE