Protein Info for AO353_26615 in Pseudomonas fluorescens FW300-N2E3

Annotation: pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 13 to 28 (16 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 13 to 131 (119 residues), 36.3 bits, see alignment E=6.4e-13 PF05834: Lycopene_cycl" amino acids 13 to 54 (42 residues), 24.7 bits, see alignment 1.8e-09

Best Hits

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_3458)

MetaCyc: 57% identical to sulfide:quinone oxidoreductase (Pseudomonas putida KT2440)
R17-RXN [EC: 1.8.5.4]

Predicted SEED Role

"FIG002984: FAD-dependent pyridine nucleotide-disulphide oxidoreductase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPU4 at UniProt or InterPro

Protein Sequence (414 amino acids)

>AO353_26615 pyridine nucleotide-disulfide oxidoreductase (Pseudomonas fluorescens FW300-N2E3)
MQDQHWGQTISADIVVIGGGTAGIGFAASLLKRDPHLNVTVIEPSAQHYYQPAWTLVGGG
AHELKNTVRPMAAVMPRQAHWVQAAVSSVDPENRLLTLDDGRSVAYQNLIVCPGLRLAWE
KIEGLQEALGQHGVTSNYSYRHAAYTWQLVKGLRGGKAIFTQPAVPIKCAGAPQKALYLS
CDHWLRHDVLKNLDVEFNLAGAALFGVAIFVAPLMKYIEKYRARLAFNSNLVKVDGPEQT
AWFEVKDAAGAVTLQAKKFDLLHVVPPQVSPDFIRQSSLADAAGWCEVDVHSLQHVRYPD
VFALGDVCSTSNAKTAAAVRKQIVVVAENVLALRKQQPLPLKYDGYGSCPLTVEKGKVIL
AEFGYAGKLLPTFPLEPTVARRSAWFLKATLLPWFYWNGMLKGREWLTRVSKVD