Protein Info for AO353_25990 in Pseudomonas fluorescens FW300-N2E3

Annotation: aspartyl beta-hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 5 to 19 (15 residues), see Phobius details transmembrane" amino acids 281 to 298 (18 residues), see Phobius details PF05118: Asp_Arg_Hydrox" amino acids 68 to 222 (155 residues), 177.6 bits, see alignment E=8.2e-57

Best Hits

KEGG orthology group: K12979, beta-hydroxylase [EC: 1.14.11.-] (inferred from 87% identity to pfs:PFLU2910)

Predicted SEED Role

"Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO" in subsystem Lipid A modifications

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VZZ2 at UniProt or InterPro

Protein Sequence (299 amino acids)

>AO353_25990 aspartyl beta-hydroxylase (Pseudomonas fluorescens FW300-N2E3)
VKLIIVSLYVLSIAYVHLRGRIRHKLSRQLSDHSTFLAPVNCFLYLFSKIPNKPYLNPAD
FPDLSPLQANWQEIRAEGQNLLRAGEIKRSDQYDDVGFNSFFKTGWKRFYLKWYGDSHPS
ATKLCPRTTELVQSIGSIKAAMFAELPPGSKLVRHRDPYAGSYRYHLGLDTPNDEGCYID
VDGERYHWRDGEAVMFDETYIHYAENTTQQNRIILFCDIERPLKYRWATAFNRWFSRNVM
SAAGAPNDAGDKTGGINRFFGKIYKIRLRGKELKKRNRTRYYLEKWAIFGGLLAIIVLI