Protein Info for AO353_25830 in Pseudomonas fluorescens FW300-N2E3

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00871: glucose-6-phosphate dehydrogenase" amino acids 16 to 502 (487 residues), 564.6 bits, see alignment E=9.2e-174 PF00479: G6PD_N" amino acids 20 to 202 (183 residues), 189.9 bits, see alignment E=6.8e-60 PF02781: G6PD_C" amino acids 205 to 501 (297 residues), 380.3 bits, see alignment E=5.5e-118

Best Hits

Swiss-Prot: 48% identical to G6PD_SYNE7: Glucose-6-phosphate 1-dehydrogenase (zwf) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 90% identity to pfo:Pfl01_2587)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.49

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WHU5 at UniProt or InterPro

Protein Sequence (504 amino acids)

>AO353_25830 glucose-6-phosphate dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MTSIRKKSKAHPAPPTTLFLFGAHGDLVKRLLMPALYNLSRDGLLGDGLRIIGVDHNAIS
DADFAKKLEDFIRAEAANKVGHDSLDPVLWAKLAKGISYVQGDFLDDSTYQALGAKIAES
GTGNAVFYLATAPRFFSEVVRRLGSSGLLEEGDDAFRRVVVEKPFGSDLHTAEALNACLL
KVMTEKQIYRIDHYLGKETVQNILVSRFSNSLFEAFWNNHYIDHVQITAAETVGVETRGS
FYEHTGALRDMVPNHLFQLLAMVAMEPPAAFGADAVRGEKAKVVGAIRPWSTEEARANSV
RGQYVAGEIAGKPLAGYCEEPNVAPDSTTETFVALKVMIDNWRWVGVPFYLRTGKRMSVR
DTEIAICFKPAPYAQFRDTEVDELQPTYLRIQIQPNEGMWFDLLAKRPGPALNMANIELG
FAYKDYFEMQPSTGYETLIYDCLTGDQTLFQRADNIENGWRAVQPFLDAWKEDASVQTYA
AGENGPTAADELLTRDGRAWHSLG