Protein Info for AO353_25720 in Pseudomonas fluorescens FW300-N2E3

Annotation: peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR01412: Tat-translocated enzyme" amino acids 9 to 424 (416 residues), 490 bits, see alignment E=5.6e-151 PF04261: Dyp_perox_N" amino acids 62 to 212 (151 residues), 126.4 bits, see alignment E=9.2e-41 TIGR01413: Dyp-type peroxidase family" amino acids 62 to 411 (350 residues), 292.9 bits, see alignment E=3.4e-91 PF20628: Dyp_perox_C" amino acids 229 to 411 (183 residues), 167.7 bits, see alignment E=2e-53

Best Hits

Swiss-Prot: 58% identical to EFEB_ECOUT: Deferrochelatase/peroxidase EfeB (efeB) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 88% identity to pfo:Pfl01_2874)

MetaCyc: 58% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLT7 at UniProt or InterPro

Protein Sequence (432 amino acids)

>AO353_25720 peroxidase (Pseudomonas fluorescens FW300-N2E3)
MNDLDQINAQRRRVLLGMGAAGVALAGSTLSCPAMAASPAQVTEAPNSAKTQDRHDFHGQ
HQTGIVTPRPACGMLVSFDVLATDREDLERLFRTLNQRIAFLMTGGPVAQVDPKFPPVDS
GILGPVVTPDNLTVTVSVGESLFDERFGLASAKPKRLIRMVGFPNDALQPELCHGDLSLQ
FCANTADTNIHALRDIVKNLPDLLLVRWKQEGSVPPQAPAKPGTPAQSARNFLGFRDGSA
NPDSNDKKTMEQIVWVQPGSDEPAWAANGSYQAVRIIRNLVERWDRTPLQEQESILGRVK
STGAPIGGSHESQVPDYAKDPHGKLTKMDAHIRLANPRTAATQANLILRRPFNYSNGVSK
NGQLEMGLLFICYQADLHNGFITVQTRLNGEPLEEYLKPIGGGYFFTLPGVTGDKDFFGR
SLLDATQPKTTA