Protein Info for AO353_25675 in Pseudomonas fluorescens FW300-N2E3

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 98 to 119 (22 residues), see Phobius details PF00378: ECH_1" amino acids 11 to 256 (246 residues), 263.3 bits, see alignment E=2e-82 PF16113: ECH_2" amino acids 14 to 185 (172 residues), 119.5 bits, see alignment E=2.3e-38

Best Hits

Swiss-Prot: 66% identical to ECHH_RHIME: Probable enoyl-CoA hydratase (fadB1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 91% identity to pba:PSEBR_a2935)

MetaCyc: 62% identical to acryloyl-CoA hydratase (Ruegeria pomeroyi DSS-3)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPE4 at UniProt or InterPro

Protein Sequence (257 amino acids)

>AO353_25675 enoyl-CoA hydratase (Pseudomonas fluorescens FW300-N2E3)
MSYETILLEVQGRVGLITLNRPQALNALNAQIVSELNHALDGLEANPEIGCIVLTGSKKA
FVAGADIKEMAELTYPQIYLDDLFSDSDRVANRRKPVIAAVAGFALGGGCELALMCDFIL
AGDNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMEMCLSGRLIDAVEAERCGIVARIV
PVDELLDEALKVAALIAKKSLPIAMMVKESVNRAFEVSLSEGVRFERRVFHAAFATQDQK
EGMAAFIAKREAQFVGK