Protein Info for AO353_25635 in Pseudomonas fluorescens FW300-N2E3
Updated annotation (from data): citrulline utilization hydrolase
Rationale: Specifically important for: L-Citrulline. This enzyme is distantly related to characterized arginine deiminases (see PF02274) and has conserved catalytic residues. It might be a citrullinase.
Original annotation: amidinotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 78% identity to pfl:PFL_3056)MetaCyc: 100% identical to citrullinase (Pseudomonas fluorescens)
Citrullinase. [EC: 3.5.1.20]
Predicted SEED Role
No annotation
MetaCyc Pathways
- L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
- L-citrulline degradation (3/3 steps found)
- cyanate degradation (3/3 steps found)
- urea degradation I (2/3 steps found)
- superpathway of allantoin degradation in yeast (4/6 steps found)
- cyanuric acid degradation II (3/5 steps found)
- cyanuric acid degradation I (2/5 steps found)
- uracil degradation III (2/5 steps found)
- superpathway of atrazine degradation (3/8 steps found)
- allantoin degradation IV (anaerobic) (2/9 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.1.20
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9VZU6 at UniProt or InterPro
Protein Sequence (311 amino acids)
>AO353_25635 citrulline utilization hydrolase (Pseudomonas fluorescens FW300-N2E3) MQTTNTVLMIRPTRFSFNQDTAANNRFQRPAAAAEDVQLKALQEFDGYVAALREHGVEVM VHNDSEAPHTPDSIFPNNWWSSHPDGTLVLYPMQGHNRRLERDKGVLDWLRDAYRIEQLL DLSDLEQQEVFLEGTGSMVLDREQRICYAGYSTRTHAKALDQVVEHLGYELCAFNAVDRH GVPIYHTNVMMSVGRQLAVVCLESVSDLDERNALRSRLECSGKQVLTLSFDQLESFAGNM LEVHNAAGEPLLVMSRTAWRSLHADQRRMVEAYAKPLPVNIDTIERIGGGSARCMLAEVY LPKRVSPQEQH