Protein Info for AO353_25550 in Pseudomonas fluorescens FW300-N2E3

Annotation: 4-amino-4-deoxy-L-arabinose transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 138 to 153 (16 residues), see Phobius details amino acids 165 to 194 (30 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details amino acids 403 to 422 (20 residues), see Phobius details PF02366: PMT" amino acids 5 to 236 (232 residues), 100 bits, see alignment E=1.6e-32 PF13231: PMT_2" amino acids 61 to 222 (162 residues), 71.1 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 77% identical to ARNT2_PSEPF: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 (arnT2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07264, 4-amino-4-deoxy-L-arabinose transferase [EC: 2.-.-.-] (inferred from 77% identity to pfo:Pfl01_2845)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VZA6 at UniProt or InterPro

Protein Sequence (549 amino acids)

>AO353_25550 4-amino-4-deoxy-L-arabinose transferase (Pseudomonas fluorescens FW300-N2E3)
MSKRWALPLLLIAFGLVYLLPLGTHGLWIPDETRYAQVSQEMLLSGNWVSPHFMGLRYFE
KPIAGYWMIAIGQAVFGENLFGVRVASALATGLSIVLTYLIARRLWNDPRKSIASALLYM
SFAVVAGQGGYSNLDPQFTFWVNLSLVALWFALDSSSRNARLMSWATLGLACGMGFLTKG
FLAWLLPVLIALPYMIWQKRWRELLAYGPMAIVVAIVVSLPWVLAVHAQEPDYWRFFFWH
EHIRRFAGDDAQHAAPWWFYLPMLVAFSLPWAAFLPSALKQAWQTRRQASTGFLLLWLVL
PLAFFSLSKGKLPTYILPCLLPLALLMGNALIDRLNLGQSRLFKVNGLLNLVIGLTTLLA
MVYLQLKKPVYVDEMHSLVLVFIVLMGWILSNLLLVVRPLSAWAAPAIGSGLLIAILPAA
LPHSVVYNKMPDQFVLQHIDELSQTKSLLSNDLGAASAAAWRLQRPEVALYNTIGEVKYG
LDYPDAAARRVDTDHVQQWMSEARKTGPVGVVMRVKGDDEVHELDLLPKDGKRYEQGNMV
ILIIPQSAP