Protein Info for AO353_25395 in Pseudomonas fluorescens FW300-N2E3

Annotation: molybdenum cofactor biosynthesis protein MoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to MOAE_PSEAE: Molybdopterin synthase catalytic subunit (moaE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 72% identity to pfl:PFL_3725)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VZR4 at UniProt or InterPro

Protein Sequence (154 amino acids)

>AO353_25395 molybdenum cofactor biosynthesis protein MoaE (Pseudomonas fluorescens FW300-N2E3)
MTVQVQTELFNLNELNSRLHAKDPGVGAVATFVGYVRDINQGEKVSSLFLEHYPGMTEQS
LQRIVDQANDRWPLQRVNIVHRVGLLNVGDPIVFVGVASEHRQAAFDACAFLMDYLKTRA
PFWKREETGSGDRWVCGRESDRLAARRWEGGDGC