Protein Info for AO353_25375 in Pseudomonas fluorescens FW300-N2E3

Annotation: cyclic pyranopterin phosphate synthase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 6 to 332 (327 residues), 376 bits, see alignment E=7.4e-117 PF04055: Radical_SAM" amino acids 19 to 179 (161 residues), 121.7 bits, see alignment E=5.4e-39 PF13353: Fer4_12" amino acids 24 to 124 (101 residues), 26 bits, see alignment E=1.6e-09 PF06463: Mob_synth_C" amino acids 186 to 314 (129 residues), 128.6 bits, see alignment E=2.2e-41

Best Hits

Swiss-Prot: 87% identical to MOAA_PSEPF: GTP 3',8-cyclase (moaA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 87% identity to pfo:Pfl01_3388)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WK49 at UniProt or InterPro

Protein Sequence (332 amino acids)

>AO353_25375 cyclic pyranopterin phosphate synthase MoaA (Pseudomonas fluorescens FW300-N2E3)
MSDRMLMDGFSRRVDYLRMSVTDRCDFRCVYCMAEDMEFLPRQRVLTLEEIYQLAESFVA
LGTRKIRLTGGEPLIRPGVVDLCKRIAALPGLRELCMTTNGSQLGKLAAPLFDAGLKRLN
ISLDSLDAKRFRELTRTGDLATVIGGIDAANAAGFQHTKLNCVVMKGRNDHEINDLVGFA
IDRGLDISFIEEMPLGVISEHSRADAFFSSAQVRERIAERYTLIESAESTQGPSRYWRLA
QAPDIRLGFISPHSHNFCATCNRVRLTVEGRLLLCLGNEHSVDLKEVLRRFPGEPERLEK
AIIESMKIKPYRHNFELNDEVQVVRFMNMTGG