Protein Info for AO353_25360 in Pseudomonas fluorescens FW300-N2E3

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 8 to 327 (320 residues), 330.8 bits, see alignment E=4.3e-103 TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 8 to 215 (208 residues), 145.3 bits, see alignment E=1.4e-46

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 91% identity to pfl:PFL_3732)

MetaCyc: 65% identical to cyanide insensitive ubiquinol oxidase subunit II (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLL0 at UniProt or InterPro

Protein Sequence (338 amino acids)

>AO353_25360 ubiquinol oxidase subunit II (Pseudomonas fluorescens FW300-N2E3)
MGIQGIDLSLIWGVIIAFGVMMYVIMDGFDLGLGILFPLIPDRQERDVMMNTVAPVWDGN
ETWLILGGAALYGAFPLAYSVILEALYLPLIFMLAGLIFRGVAFEFRFKASPEKRHIWDM
AFIGGSLLATFCQGIVIGAYIAGIPVVNRQFAGGTLDWLSAFPLFCGFGLIVAYALLGST
WLLVKTEGMLESRMRHYTRPLAFTLTAVVAVLCVWTPMLHPEIAIRWFTHAHTVVFGGLL
ILGVLALFGLLRSLRHYHSHWPFVFTLALVFLGYIGLAFSIWPNIVPPSISLWEAASPPS
SQLFILIGTLFILPIILMYTCWSYYVFRGKVRIGDGYH