Protein Info for AO353_25305 in Pseudomonas fluorescens FW300-N2E3

Annotation: malonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details TIGR00808: malonate transporter, MadM subunit" amino acids 1 to 254 (254 residues), 444 bits, see alignment E=8.7e-138 PF03818: MadM" amino acids 8 to 252 (245 residues), 401.5 bits, see alignment E=7.1e-125

Best Hits

KEGG orthology group: None (inferred from 91% identity to psb:Psyr_0450)

Predicted SEED Role

"Malonate transporter, MadM subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLK2 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AO353_25305 malonate transporter (Pseudomonas fluorescens FW300-N2E3)
MWNLMEAGLKHNDLVTAFAFVGVIMWISVVLSKRLTFGRIHGSAIAIVIGLVLAWVGGTL
TGGQKGLADVAVFSGIGLMGGAMLRDFAIVATAFEVQATEARKAGLIGALALLLGTVLPF
IVGASIAWMFGYRDAVSMTTIGAGAVTYIVGPVTGAAIGASSDVVALSIATGLIKAILVM
VGTPMAARWMGLDNPRSAMVFGGLAGTVSGVTAGLAATDRRLVPYGALTATFHTGLGCLL
GPSLLYFIVRGIVG