Protein Info for AO353_25300 in Pseudomonas fluorescens FW300-N2E3

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF00126: HTH_1" amino acids 9 to 63 (55 residues), 48.3 bits, see alignment E=7.7e-17 PF03466: LysR_substrate" amino acids 96 to 297 (202 residues), 136.5 bits, see alignment E=8.8e-44

Best Hits

Swiss-Prot: 47% identical to MAUR_KLEPN: Malonate utilization transcriptional regulator (mauR) from Klebsiella pneumoniae

KEGG orthology group: K13928, LysR family transcriptional regulator, malonate utilization transcriptional regulator (inferred from 97% identity to pfo:Pfl01_5293)

Predicted SEED Role

"Malonate utilization transcriptional regulator" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WAD8 at UniProt or InterPro

Protein Sequence (304 amino acids)

>AO353_25300 LysR family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MLIDEELTLKKLEVFLAFMRTGNLARAAAELQTSNVSVHRAIHSLESALRCPLFKHEGRN
LTPLESAYVLEERAQKLIQDVLESVRLTREAAGFSAERFKLGSLYSLTVKTVPQLIMGLK
IRRSELNIDLILGSNIDLLYKLKNMEVDAILVSLDDTVNDPDCEQIPLFSDDIFLATPAD
SPFAQRAEVDLAEVRNETFITLTQGFATHQDGIRVFQQAGFEPKVAMQVNDIFTLLSMVS
SGVGYALLPGRIAAVYENRVKLIPLQERYRLQQHIGVVFLKAKERDPNLLALLAECRMYA
NRQA