Protein Info for AO353_25195 in Pseudomonas fluorescens FW300-N2E3

Annotation: NAD(P)H:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR01755: NAD(P)H:quinone oxidoreductase, type IV" amino acids 2 to 198 (197 residues), 322.5 bits, see alignment E=5.9e-101 PF00258: Flavodoxin_1" amino acids 6 to 125 (120 residues), 46.5 bits, see alignment E=4.4e-16 PF03358: FMN_red" amino acids 16 to 143 (128 residues), 45.7 bits, see alignment E=5.4e-16

Best Hits

Swiss-Prot: 92% identical to NQOR_PARPJ: NAD(P)H dehydrogenase (quinone) (Bphyt_6351) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 92% identity to bpy:Bphyt_6351)

MetaCyc: 66% identical to PnpB (Pseudomonas sp. WBC-3)
2-hydroxy-1,4-benzoquinone reductase. [EC: 1.6.5.7]; p-benzoquinone reductase (NADPH). [EC: 1.6.5.7, 1.6.5.6]

Predicted SEED Role

"Flavoprotein WrbA"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.6 or 1.6.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WP56 at UniProt or InterPro

Protein Sequence (200 amino acids)

>AO353_25195 NAD(P)H:quinone oxidoreductase (Pseudomonas fluorescens FW300-N2E3)
MAKVLVLYYSMYGHLETMAGAVAEGARSVPGTDVTLKRVAETIPAEQAAAIGVKLDQKAP
VATPDELGNYDAIIFGTPTRFGNMAGQMRTFLDQTGGLWMSGALVGKIGSVFASTGTQHG
GQETTITSFHSTLLHQGMVIVGVPYTCAGLTNMSEITGGTPYGATTLAGTDGKRQPSQNE
LDIARFQGKHVAELAIKIAG