Protein Info for AO353_25180 in Pseudomonas fluorescens FW300-N2E3

Annotation: acetylpolyamine aminohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00850: Hist_deacetyl
  • amino acids 27 to 335 (309 residues), 232.2 bits, E=4.6e-73

Best Hits

Swiss-Prot: 57% identical to APAH2_PSEAE: Acetylpolyamine amidohydrolase 2 (aphB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2903)

MetaCyc: 46% identical to acetylpolyamine amidohydrolase subunit (Mycoplana ramosa)
Acetylputrescine deacetylase. [EC: 3.5.1.62]

Predicted SEED Role

"Deacetylases, including yeast histone deacetylase and acetoin utilization protein" in subsystem Hydantoin metabolism

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.62

Sequence Analysis Tools

See A0A0N9WAC7 at UniProt or InterPro

Protein Sequence (344 amino acids)

>AO353_25180 acetylpolyamine aminohydrolase (Pseudomonas fluorescens FW300-N2E3)
MFTVFSDSHRLHHGTELKDGVLKPSFEQPSRADTVHNRVKQVGLGQIVEPRIFDRSCYVN
AHSERYVSFLESAWSEWCATGRTHDALPLVWPVRDLSNEQVPTFIDGKLGFYAMDAGSPI
TATTWQAVKTSADIALTGLALIDEGHDSAFALCRPPGHHAAREYMGGYCYLNNAAIAAQQ
AITQGSKRVAVLDVDFHHGNGTQNIFYGRSDVMFVSLHGEPTVSYPYYSGFSHEVGAGHG
EGYNLNYPLPKNTTWESYRNALLHACKKLQQFAPEVLVISLGVDTFKDDPISHFLLESED
FIGIGELIAGVGCPTLFVMEGGYMVDEIGINAVNVLHGFESKRA