Protein Info for AO353_25150 in Pseudomonas fluorescens FW300-N2E3
Annotation: acetoin dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to ACOC_PSEPU: Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (acoC) from Pseudomonas putida
KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 85% identity to pba:PSEBR_a3210)Predicted SEED Role
"Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex (EC 2.3.1.-)" in subsystem Acetoin, butanediol metabolism (EC 2.3.1.-)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Citrate cycle (TCA cycle)
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycolysis / Gluconeogenesis
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Pyruvate metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.12
Use Curated BLAST to search for 2.3.1.- or 2.3.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9X0R9 at UniProt or InterPro
Protein Sequence (370 amino acids)
>AO353_25150 acetoin dehydrogenase (Pseudomonas fluorescens FW300-N2E3) MSQIHTLTMPKWGLSMTEGRVDAWLKEEGQVIAKGDEVLDVETDKISSSVEAPFSGVLRR QIARQDETLAVGALLGIVVDGEASEVEIDAVVEQFQATFVPGDDAEEDRGPKPQKVELDG RLIRYFERGEGGVPLVLVHGFGGDLNNWMFNHEALAAGRRVVALDLPGHGESTKQLERGD LDELSGIVLALLDHLDIPAAHLVGHSMGGAVSLNIARLEPQRVRSLILIGSAGLGEGING DYLEGFVEAANRNALKSQLVKLFSNPELVNRQMLEDMLKYKRLEGVGAALRLLVSGVFKD GSQQLDLRGVVQDGQQPVLLIWGSDDAIIPANHSAGLKAQVEVLPGQAHMVQMEAAEQVN RLILDFVQQH