Protein Info for AO353_25020 in Pseudomonas fluorescens FW300-N2E3

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 120 bits, see alignment E=4.6e-39

Best Hits

KEGG orthology group: None (inferred from 73% identity to pfl:PFL_3323)

Predicted SEED Role

"putative amino acid efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VZK9 at UniProt or InterPro

Protein Sequence (209 amino acids)

>AO353_25020 lysine transporter LysE (Pseudomonas fluorescens FW300-N2E3)
MDASTLFLYIITVSVVMMTPGPSMLLALSNGASKGMRVASFGMAGAALSDLILIGAVGCG
LGALLQASEQLFILVKWVGTAYLLYLAWVLWHAPTRALSEAYTPSAATGRSAFLRALLVG
LSNPKGLLFFAAFLPQFIRPSEPVAQQYVLLAITSALVDCVMMSMYAFGGRLAMRRFSSQ
VMQWINRSCAGMLALLALGLTLYRRNPSH