Protein Info for AO353_25000 in Pseudomonas fluorescens FW300-N2E3

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details PF00571: CBS" amino acids 83 to 136 (54 residues), 24.7 bits, see alignment 2.4e-09 PF01769: MgtE" amino acids 204 to 327 (124 residues), 111.1 bits, see alignment E=4.4e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 76% identity to cvi:CV_3245)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X329 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AO353_25000 magnesium transporter (Pseudomonas fluorescens FW300-N2E3)
MASATPSTFKDIRLKDTVVSYMSPLLITVTGNMTVIQAREHLLKQLPDDDIPAHIFVTDP
RSALHGQLSVKTLLTEKNTDLCVRDLMLPIRFSVSPNQLRHDVAPELIEKGVDIVPVVSE
GRLLGVLYEKEIAALIQDEGTDDAQRQGASLPLETPYLSTSPWSLWKKRLPWLLLLFLAE
AYTSTILQVFEEQLEAAIALAFFIPLLIGTGGNSGTQITSTLVRAMALGEVSLRNVGTVL
RKEVTTSFMIALAIGVVAWIRAWMLGVGSEIAMVVCLTLVAITIWSAVVSSIIPMLLRKL
RIDPAVVSAPFIATFIDGTGLVIYFNIAKLVMTDLPA