Protein Info for AO353_24970 in Pseudomonas fluorescens FW300-N2E3

Annotation: formate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 5 to 284 (280 residues), 458 bits, E=4.9e-142
• PF12838: Fer4_7
  • amino acids 33 to 110 (78 residues), 37 bits, E=2e-12
• PF13247: Fer4_11
  • amino acids 88 to 184 (97 residues), 87.7 bits, E=2.5e-28
• PF13237: Fer4_10
  • amino acids 90 to 140 (51 residues), 25.2 bits, 6.9e-09
• PF12837: Fer4_6
  • amino acids 121 to 143 (23 residues), 25.3 bits, see alignment (E = 5.4e-09)
• PF12797: Fer4_2
  • amino acids 122 to 141 (20 residues), 24.6 bits, see alignment (E = 8.5e-09)
• PF00037: Fer4
  • amino acids 123 to 143 (21 residues), 26.5 bits, see alignment (E = 2.1e-09)
• PF13187: Fer4_9
  • amino acids 128 to 180 (53 residues), 27.7 bits, 1.1e-09
• PF09163: Form-deh_trans
  • amino acids 242 to 285 (44 residues), 77.9 bits, 2e-25

Best Hits

Swiss-Prot: 67% identical to FDOH_SHIFL: Formate dehydrogenase-O iron-sulfur subunit (fdoH) from Shigella flexneri

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 90% identity to pen:PSEEN0565)

MetaCyc: 67% identical to formate dehydrogenase O subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• nitrate reduction III (dissimilatory) (2/2 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See A0A0N9WAA6 at UniProt or InterPro

Protein Sequence (316 amino acids)

>AO353_24970 formate dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MANQDIIARSATTTLPPSVRQQEEVAKLIDTTKCIGCKACQVACSEWNELRDEVGHNHGT
YDNPQDLSAETWTLMRFTEHETDAGNLEWLIRKDGCMHCAEPGCLAACPSPGAIIKHANG
IVDFDQDHCIGCGYCITGCPFNIPRISRKDHKAYKCTLCSDRVAVGLEPACVKTCPTGAI
VFGSKEDMKEHAAERIVDLKSRGFDNAGLYDPAGVGGTHVMYVLHHADQPSLYAGLPNQP
VISPLVGLWKGVSKPLALLAMGAAVLAGFFHYVRIGPQRVEEDEHPPGKDSSVHEVDPTV
HVYDPNTPGSQEDRRP