Protein Info for AO353_24890 in Pseudomonas fluorescens FW300-N2E3

Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 84 to 459 (376 residues), 298.3 bits, see alignment E=5.9e-93 PF13091: PLDc_2" amino acids 107 to 216 (110 residues), 42.9 bits, see alignment E=4.2e-15 amino acids 304 to 429 (126 residues), 103.4 bits, see alignment E=8.3e-34 PF00614: PLDc" amino acids 195 to 216 (22 residues), 24.2 bits, see alignment (E = 2.6e-09)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 64% identity to meh:M301_0983)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VU60 at UniProt or InterPro

Protein Sequence (464 amino acids)

>AO353_24890 cardiolipin synthase (Pseudomonas fluorescens FW300-N2E3)
MNLFSMRILLRTLTVLSLTLLVACGSLPTIVPDMAYTNPASVKIDSTHGPLSAERSKAVI
DRLKANGVQTNIFDLHMAIEEAIVGSPLTDGNKVELLQNGPTTYQSMISAIGSARDHINI
ESYIFDDDEIGERFAAALIAKQAAGVQVNLIRDSVGTLSTPSAFFTRLTAAGINVLEFNP
VNPATAKAGWQVNQRDHRKLLIVDGRIAFLGGINVSSVHSGNSFSLNAKVRPGGKLPWRD
TDLRVEGPAVAELQKLFIETWQKQKGKPLAARHYFPQTERKGHEVVRAIGSSPDEPYSLI
YATLISALRSAQTEIWLTNAYFVPDPQLLAELKNAVARGVDVKLVLPSSTDSWLVFNAGR
RHYTELLEAGVKLYERRDALLHVKTAVIDGVWSTVGSTNLDWRSFLHNQEVNVVVLGSGF
GEKMRAAFLADLLKSNEITLEKWQRRSLDVRAKEQFAHLWEYWL