Protein Info for AO353_24820 in Pseudomonas fluorescens FW300-N2E3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 150 to 170 (21 residues), see Phobius details PF17149: CHASE5" amino acids 36 to 142 (107 residues), 48.7 bits, see alignment E=1.6e-16 PF00512: HisKA" amino acids 267 to 332 (66 residues), 67.1 bits, see alignment E=3e-22 PF02518: HATPase_c" amino acids 380 to 496 (117 residues), 106.5 bits, see alignment E=2.7e-34 PF00072: Response_reg" amino acids 516 to 628 (113 residues), 80.5 bits, see alignment E=2.7e-26 PF01627: Hpt" amino acids 664 to 745 (82 residues), 37.4 bits, see alignment E=6.4e-13

Best Hits

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQ46 at UniProt or InterPro

Protein Sequence (753 amino acids)

>AO353_24820 histidine kinase (Pseudomonas fluorescens FW300-N2E3)
MIRARPGGLLRRLLLFILLFSLCFTVLASTVQLYFEYRREMRDIDSRMELIRAGYLASLE
RSLWDLNQEQLNVQLRGLVDFSDVARVHLTSPDFDLLQGNQAPIGPLRVERFELDYQPPA
GPVRHLGQLEVSTDLGAVHQRLFATGLTSLLWMSVFLCGLAVALSGLFYRLVTRHLQVMA
GFARRIAAGEWHEPLHLDKSRGVNEDEIDTVAHALDDMRRAILSDIDRRETDRLALQDNR
DELLRMVERRTASLMRAKDEAEAANLAKSRFLATMSHELRTPLNGILGMAELLRGASLDE
RDGKRLDALYKAGEGLLTILNEVLYFARLEEGETHPEPVDFSIRHLLDEVLTLLEPRALS
NDTTLHCRIDPQVADRQHGAEQFLRQVLSNLLANAIKFTEGGRVSVEVTLLAQDSGQAGQ
RLRLSVTDNGIGIAPAMQAKIFERFTQASEDVAQRFGGTGLGLAISKHLVEQLGGQIGVQ
SERGQGSCFWFELTLQPATGMIDVVSSSAAGHVLNVLVVEDVALNRDVVSGLLQRDGHQV
WLAEEAEQALAQCASQTFDLILLDVHLPGISGVELCKLIRSSAGPNRHSRIFALTASVQP
ALVRGYLDVGMDGILAKPLKLENLRQALAGQSPIPEPQPNDEAMDWPLLQTHRTLLGEQK
VQGLLAVLRNSITQHQEALTEAIEADDCTEVAHLAHRLAGSSDSLGFRALANVLRLLEEA
ALVNDEPALRALAPQVHEQLQHSQQTLAELLNA