Protein Info for AO353_24380 in Pseudomonas fluorescens FW300-N2E3
Annotation: potassium transporter KefF
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to KEFF_ECOL5: Glutathione-regulated potassium-efflux system ancillary protein KefF (kefF) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)
KEGG orthology group: K11746, glutathione-regulated potassium-efflux system ancillary protein KefF (inferred from 78% identity to pba:PSEBR_a3522)MetaCyc: 60% identical to regulator of KefC-mediated potassium transport and quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]
Predicted SEED Role
"Glutathione-regulated potassium-efflux system ancillary protein KefF" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis
MetaCyc Pathways
- vitamin K-epoxide cycle (1/4 steps found)
- superpathway of photosynthetic hydrogen production (2/6 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.6.5.2
Use Curated BLAST to search for 1.6.5.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9WSK1 at UniProt or InterPro
Protein Sequence (173 amino acids)
>AO353_24380 potassium transporter KefF (Pseudomonas fluorescens FW300-N2E3) LILIIYAHPYPEKSLVNRAMLERVSSNPDIVIRSLYDLYPDFNIDVEAEQKAVDQAQLLV LQHPMYWYSSPPLLKLWIDKVFTHGWAYGKGSVALKDKSLLWAVTTGGEHDHFQIGNHPG FSVLAQPLHATAIYCSMRWLNPVVVHGAYAAAPDSLHSQIEHYYARLASWKED