Protein Info for AO353_24370 in Pseudomonas fluorescens FW300-N2E3

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF04756: OST3_OST6" amino acids 2 to 81 (80 residues), 34.8 bits, see alignment E=2.5e-12 PF00085: Thioredoxin" amino acids 5 to 101 (97 residues), 69.9 bits, see alignment E=3.4e-23 PF13728: TraF" amino acids 8 to 101 (94 residues), 23.4 bits, see alignment E=9.3e-09 PF13098: Thioredoxin_2" amino acids 21 to 100 (80 residues), 27.1 bits, see alignment E=8.8e-10

Best Hits

Swiss-Prot: 31% identical to THIO_HELPJ: Thioredoxin (trxA) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: None (inferred from 71% identity to pst:PSPTO_4260)

Predicted SEED Role

"Thiosulfate sulfurtransferase, rhodanese (EC 2.8.1.1)" (EC 2.8.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X0G0 at UniProt or InterPro

Protein Sequence (109 amino acids)

>AO353_24370 thioredoxin (Pseudomonas fluorescens FW300-N2E3)
MNRIVDLKAEQFARFVAKGSSVVLFSASWCKPCQEMKPVFHDLADKLHSRAAFGRIDVAV
SPTISQMYGIRSVPSLAIFHEGRLRLVLAGSRSAAALKKAILADLKDVF